Paidy was founded with the mission to create a world of “We remove the barriers, embrace simplicity”, offering its real-time monthly consolidated credit service all across Japan. Paidy started Japan’s first instant post-pay credit service for ecommerce consumers in October 2014. Paidy requires no pre-registration or credit card to use; Paidy consumers purchase products online using only a mobile phone number and email address (verification is established though a four-digit code via SMS or voice pin-code) and settle a single monthly bill for all their purchases, either at a convenience store, by bank transfer or auto debit. Paidy also supports multi-pay installments and subscriptions. There are currently almost 4,000,000 Paidy accounts in use (Oct 2020)!! Paidy has proved a powerful means of persuading first time buyers to transact online. Its proprietary models and machine learning mean that transactions are underwritten in seconds, with guaranteed payment to merchants. Paidy increases merchant revenues by reducing incomplete transactions, increasing conversion rates, boosting average order values, and facilitating easy repeat buying.

scalajavaakkacassandradistributed systemsci/cdkafkafunctional programmingjvmpension contributionsdiverse management teamjapanese speaking lessons2 months relocation/housingtyped functional programming

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockercontinuous deploymentcontinuous integrationcloud

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactgcpawsgraphqlremote workingflexible workinglaptopequipment budget30 days annual leave + bank holidaysprivatetechnology

node.jsjavascriptreactkubernetes

With over 16,000 people worldwide, we make a huge investment in everyone, offering great career development opportunities. Our people make William Hill what it is and we offer a fast-paced environment where we have fun, celebrate success and give you all the tools you’ll need to be your best self. It’s not just our colleagues we look after – we’ve got a responsibility to our customers too and we work hard on our ambition that nobody is harmed by gambling. Join us #behindthebet and find out more.

scalajavanode.jsreactswiftdockerphpci/cdkafkapuppetreduxansiblekotlinaws

node.jsreactreact nativetypescript

Hyperscience is a technology company blazing a new path in enterprise automation with a reimagined approach to building and powering processes. The Hyperscience Platform is the world's first Software-Defined, Input-to-Outcome Automation platform used by top public companies and government organizations around the world to build and run mission-critical processes with ease and speed.

pythonreactdockerkubernetesdjangopostgresqlwebpackpostcssansibleterraformjenkinsms sqloracle sql serverremote working

pythonjavascriptreactdjango2.0redux

The BaseN Platform is a redundant, distributed collection of services for very high volume data reception, storage, monitoring, analysis, and visualization. We're founded in 2001, have operations in 7 countries and provide a good and stable environment for all of our employees. We need to expand our international multi-disciplinary team with great team members!

javajavascriptmonitoring1passwordcommunicationgolangslackdistributed computingbare metal environmentvs codeeclipseremote workingflexible workinghealth insurance

pythonnode.jsjavascriptgo

Serokell is a custom software development and consulting company working with functional programming technologies in spheres such as blockchain. Serokell is fully remote — our diverse background and fast-moving environment make everyday communication and workflow creative and fun. Our international team consists of talent from various spheres: software engineers, computer scientists, mathematicians, and many more inventive individuals. We work flexible hours in small, friendly teams and abide by certain principles: as little bureaucracy as possible (no unnecessary meetings, super detailed reports, etc.), proper management, healthy work/life balance, and continuous improvement. More info at serokell.io.

haskellelixirrustc++agdanixtypescriptremote workingflexible workinggreat tech stackinternal trainingprivatetechnology

scalapythonnode.jsjavascriptdockertypescriptawsapi integrations

Gemini Trust Company, LLC (Gemini) is a licensed digital asset exchange and custodian. We built the Gemini platform so customers can buy, sell, and store digital assets (e.g., Bitcoin, Ethereum, and Zcash) in a regulated, secure, and compliant manner. Digital assets and blockchain technology have the power to transform the world for good. This truth, along with our core values, form the bedrock of our company and culture. At Gemini, no job is too small and no project too big as we endeavor to build the future of money. We are a mission-driven, team-based, inclusive, and determined community of thought leaders who invest in each other and the long game. Come join the Gemini team and help us build the future of money. We believe in the transformational power of digital assets, and want to work with people who have passion, integrity, and perseverance. We’re committed to excellence and building a truly galaxy-changing team. If this sounds like you, apply for a seat on the Gemini Spaceship today! 🚀

scalapythonjavac++javascriptlinuxmonitoringci/cdcode reviewscomplianceansibleon call physical data centrebare metal environment

PathAI's mission is to improve patient outcomes with AI-powered pathology. Our platform promises substantial improvements to the accuracy of diagnosis and the efficacy of treatment of diseases like cancer, leveraging modern approaches in machine learning. We are a company of diverse employees with a wide range of backgrounds and experiences. Our world class team is passionate about solving challenging problems and making a huge impact. Our office is located in the heart of Fenway. PathAI was recently voted one of Boston's Best Places to Work!

pythondjangovue.jsawspostgressremote workingflexible workingfree meals & snacksamazing officeseries bhealth

O(1) Labs is a small, well-funded startup aiming to develop the first cryptocurrency protocol that can deliver on the promise of supporting real-world applications and widespread use. Our team is based in San Francisco, and we are funded by top investors (including Polychain, Metastable, Max Levchin, and Naval Ravikant). O(1) Labs recently released Coda Protocol, the first cryptocurrency with a constant sized Blockchain. O(1) Labs is committed to building a diverse, inclusive company. People of color, LGBTQ individuals, women, and people with disabilities are strongly encouraged to apply.

ocamlelmpurescriptreasonmlflexible working401koffice libraryparental leavebike friendlyhealthy snacksequityfull healthcare coverage401(k) matchingcommitted to a diverse team

Through our dedicated tech hubs and the use of open source issues, WorksHub is changing the way Software Engineers find new opportunities. Our tech hubs bring together communities of Software Engineers 👩💻 where they can: Discover new companies hiring Get paid to solve real problems through our innovative Open Source issues solution Learn new skills through our Open Source issues or demonstrate skills on our learn section before applying to a new job Get expert advice on finding a new job with the support of one of our Talent Managers. Our Talent Managers focus on specific technologies in set geographies so we know how to speak your language whether that’s Clojure, Haskell, English or Japanese! For companies hiring we help them access the right talent in the right way! We are a team of Software Engineers, Data Scientists and Talent experts so we know how to represent the fastest growing tech companies. We believe that through our data-driven approach we can reduce the the time to hire from weeks to days. We are striving to build something amazing, we want to work on hard, interesting problems, and to surround ourselves with the brightest technology professionals in the world!

clojureclojurescriptmongodbherokualgoliaghost inspectorci/cd1passwordgithubsentrygoogle analytics sendgridslacksegment

Driving the evolution of B2B with an integratable Customer Insight Engine. Analyze win-loss data and enrich it to learn causative selling patterns—defining the probability of acquisition, loss, and churn. Find new ways to make more pragmatic busi...

pythonnode.jsreactaws lambdareduxawsremote workingflexible workingequal pay policyunlimited vacationequitypromote from withincommitted to a diverse team flexible pto/unlimited sick days

Travel with the people you love. Group travel has never been this easy - check out our homes and locations across the country. Collectively, we’ve traveled to over 80 countries and know what matters most - creating an authentic experience. We believe the best travel accommodations are all about delivering an exceptional, unique stay and far too often property managers and hosts fall short on delivering a first-class short-term rental experience. AvantStay is here to change that by setting the new standard for short-term rental experiences. Our team is incredibly passionate about real estate, technology and the arts. We came together to build a revolutionary hospitality brand through the power of virtual tech automation in the short-term rental market. With offices in San Francisco and Los Angeles, we currently operate in 7 markets across the United States. Our proprietary tech algorithm and data experts identify partnership opportunities and automate operations through our virtual management system to maximize efficiencies and improve the overall guest experience.

scalakinesisaws lambdamonixpostgresqlcode qualitycode reviewsslackg-suitecatsgitlabremote workingflexible workingseries a

node.jsjavascriptreactdockertypescriptaws

The user data cloud, built on unstoppable and open distributed data infrastructure and powering a new generation of apps that let devs built lighter, faster, more secure, more amazing products, with ease. #BuildBetter

node.jsjavascriptethereumtypescriptremote workinglearning budgetretreats at unique locationsflexible budget available to attend learning and development opportunities such as meet-ups and conferencestravel opportunitiesgreat tech stackmodern tech-stackseedblockchain

Truecaller is a Swedish company founded in 2009 in Stockholm, Sweden by Nami Zarringhalam and Alan Mamedi. The app began when our co-founders were just students who wanted to create a service that would easily identify incoming calls from unknown numbers. We have our strongest presence in South Asia, Middle East, Africa, and HQ in Sweden. We are backed by some of the most prominent investors in the world such as Sequoia Capital, Atomico, and Kleiner Perkins Caufield & Byers. Today, Truecaller is loved by over 150 million daily active users around the world and is the go-to app for Caller ID, spam blocking and payments. At Truecaller, we strive to make communication more safe and efficient around the world. We give you the ability to conquer new challenges, work with big data, an international team, and the opportunity to build a career you love. Join us in our mission to make the world’s best communication app.

scalajavajavascriptdistributed systemskubernetesjvmsparkbig dataflexible workingpension sponsorship availablelate stage venturetechnology