We're building a better financial world. Over the past ten years, we have built a machine learning and technology platform that is revolutionising how small businesses access finance. Business owners can complete a loan application and receive a decision in a matter of minutes, enabling them to get funding quickly at an affordable rate. Today, as the leading global provider for small business loans we have helped more than 100,000 small businesses access more than £11.5 billion in finance. Funding Circle is the largest online small business loans provider and one of the best-capitalised lending platforms in the world. The business is listed on the London Stock Exchange (Ticker: FCH). Our backers collectively manage over $5 trillion and are the leading firms behind Facebook, Twitter, Skype and Betfair. Build the incredible, with us!!

clojurejavarubyjavascriptreacthtmlcsslinuxdockerawsci/cdcode qualitycode reviewsfunctional programming

We analyse online news and public social media to help organisations understand the factors that impact their reputation, and how they can be better. We use clever algorithms and machine learning to build a software-as-a-service (SaaS) app where customers can view and explore these insights.

clojuredatomicelasticsearchkafkaremote workingflexible workingpension 25 days holiday + all bank holidaysprivatetechnology

Tackling the complex banking system to empower people in one of the world's most bureaucratic markets seems like a crazy idea, right? But that's why, how, and where Nubank was born. We fight complexity through our transparent and straightforward products and experiences: a no-fee credit card, a rewards program, a lending platform, and a digital savings account. In a nutshell, we are the most innovative tech company in Latin America, and we are obsessed with building financial services and products that make our customers love us fanatically. With over 34 million customers and $1 billion raised in investment rounds, we are the fastest growing digital bank in the world, with offices in Brazil, Germany, US, Mexico, Colombia and Argentina. And it's still only Day One for us! We're actively servicing around 30 million customers via our mobile-controlled credit card product, since our launch on September 2014. We have done this by developing simple, secure and 100% digital solutions. With our HQ located in the heart of São Paulo, Brazil and an data engineering office located in Berlin, Germany...Nubank is now worth $4billion. Diversity and Inclusion We want to build products and experiences for everyone who wants to take back control over their finances, that's why we build strong and diverse teams that rise up to the challenge. We are a team of the most creative people in technology, and we hire under equal opportunity, irrespective of gender, ethnicity, religion, sexual orientation or background. We are proud to say that 30% of our team recognize themselves as part of the LGBTQ+ community, and 40% of our team identify as women, in all positions and seniority levels. We are a very process-light organization that values human interactions, and that is a very important part of our culture. At Nu, everyone has the opportunity to speak up and participate, grow and share ideas. Benefits: Relocation package (travel tickets for the candidate and their family, accommodation, relocation allowance) and full support for the visa process, if necessary RSUs (restricted stock units) 28 days of vacation Support with English, German or Portuguese classes Flexible hours Learning benefit: Each employee has 1000 EUR gross to spend on educational activities or material (e.g. conference, workshops or online training, subscriptions). Wellness benefit: The company grants the employee 300 EUR per year for wellness activities.

clojurerubyjavascriptawscontinuous integrationdatomicfunctional programmingkafkasparkflexible workingdiversity dedicated staffrelocation budgetequitywellness budget

We’ve been redefining what’s possible in clinical trials for over 20 years. Only Medidata combines the wealth of data, AI powered insights, and patient-centric solutions required to bring tomorrow’s breakthrough therapies and devices to life, and into the hands of patients. Medidata is leading the digital transformation of life sciences, creating hope for millions of patients. Medidata helps generate the evidence and insights to help pharmaceutical, biotech, medical device and diagnostics companies, and academic researchers accelerate value, minimize risk, and optimize outcomes. More than one million registered users across 1,400 customers and partners access the world's most-used platform for clinical development, commercial, and real-world data. Medidata, a Dassault Systèmes company, is headquartered in New York City and has offices around the world to meet the needs of its customers. Discover more at www.medidata.com.

clojurejavascriptawsaws lambdaremote workingflexible workinghealth insurancedental insurancevision insurancediversity dedicated staffdiverse management teamparental leaveflexible parent workingunlimited vacation

Over 1 billion smallholder farmers produce 80% of the world's food, and four of the five most traded commodities on earth, yet the vast majority lack access to the internet and even basic information to help them solve problems or share ideas. No one has built a platform for these farmers. Until Wefarm. Wefarm is already the world’s largest farmer-to-farmer digital network, with more than 1 million farmers using our ecosystem in Kenya and Uganda alone. Our farmers share more than 40,000 questions and answers every day. Farmers connect with one another to solve problems, share ideas, and spread innovation, for free, and without needing an internet connection (Wefarm works even through SMS). Utilising the latest machine learning technology, Wefarm’s service gets bespoke, crowd- sourced information to help farmers increase yields, gain insight into pricing, tackle the effects of climate change, source the best quality seeds, fertiliser, and loans and diversify their agricultural interests. With the smallholder global agricultural market valued at over 400 billion USD, our vision is to create a digital online/ offline ecosystem for global smallholder agriculture. WeFarm has won Google’s prestigious Impact Challenge Award, the MEFFYS Award for Innovation in Technology, the Messaging and SMS World Awards’ Best SMS Solution, Business Rocks’ Global Startup Pitch Battle, Chivas Regal’s The Venture Competition’s UK prize, and 2nd place in their Global final and the European Union Commission’s Ideas from Europe Prize.

clojureclojurescriptdockerawscode qualitycode reviewskuberneteskafkamachine learningmysqlnlppostgresqlslacktravis-ci

Through our dedicated tech hubs and the use of open source issues, WorksHub is changing the way Software Engineers find new opportunities. Our tech hubs bring together communities of Software Engineers 👩💻 where they can: Discover new companies hiring Get paid to solve real problems through our innovative Open Source issues solution Learn new skills through our Open Source issues or demonstrate skills on our learn section before applying to a new job Get expert advice on finding a new job with the support of one of our Talent Managers. Our Talent Managers focus on specific technologies in set geographies so we know how to speak your language whether that’s Clojure, Haskell, English or Japanese! For companies hiring we help them access the right talent in the right way! We are a team of Software Engineers, Data Scientists and Talent experts so we know how to represent the fastest growing tech companies. We believe that through our data-driven approach we can reduce the the time to hire from weeks to days. We are striving to build something amazing, we want to work on hard, interesting problems, and to surround ourselves with the brightest technology professionals in the world!

clojureclojurescriptmongodbherokuawsci/cdgithubgraphqlslackgoogle analytics algoliasegmentsendgridsentry

Freshcode is a Europe-based software development company, founded in 2014. The goal-oriented and motivation-driven team provides startups and small&midsize businesses with IT services of any difficulty. Freshcode completed 120 projects for customers in the US, Canada, Germany, Denmark, Israel, Australia, etc. We have been using Clojure for 7 years as a core technology of our company and we never were disappointed. The most value that working with Clojure or ClojureScript gives us is a highly-skilled community, which acts as a small family of people loving what they’re doing. In March 2020 we started a Clojure and functional programming community in our city and we keep growing it. Find out more information on our website: https://freshcodeit.com/services/clojure-development-company

clojureclojurescriptnode.jsjavascriptreact.netreact nativeremote workingflexible workingpaid sick daysdaily stand upperformance bonusdiverse management teamteam events

Launched in January 2015, OnTheMarket.com is the simple way to search for property. We aim to provide all potential buyers, sellers, landlords and tenants with an exceptional property search service. Thousands of estate and letting agents are listing their properties at OnTheMarket.com and many are advertising their new properties exclusively with us first: 24 hours or more ahead of other portals. If you're looking to buy or rent, make sure you don't miss out on these properties and set up an instant property alert today. Every property you see at OnTheMarket.com is on the market with full-service estate or letting agents who are experts in their local area. OnTheMarket.com also has complementary search services for overseas properties for sale and for commercial UK properties to rent and for sale.

clojureclojurescriptjavascriptawslambdajenkinssqskinesissnss3elastisearchreddispostgressremote working

Timezynk is a technology forward full-remote SaaS company that is passionate about functional programming, scalable software, agile teamwork and applying new technology to real-world problems. Our values are 🤝 Collaboration, 📈 Results, 📖 Openness, ⛰️ Integrity, 🌐 Diversity and 👣 Iteration and we live them through the decisions we make and the software we write, sell, deliver and support. We are an open-core company and you can read more about our strategy, values and goals at https://timezynk.gitlab.io/han...

clojurenode.jsreactremote workingflexible workingbookscareer advicedaily stand uphealth care contributionsgym passesprivatetechnology

The Market Infrastructure Ecosystem The increased regulatory burden put on market operators through the past decades has resulted in a decline in competition and the quality of service. It has never been harder for investors to invest in what they want, despite the vast technological developments that have taken place in the industry. We believe that people have a right to participate in free markets, but ultimately we realized we would have to rebuild the financial system from the ground up to facilitate this change. This is why the founder of Braveno - Mathias Groennebaek, helped found Ethereum to bring about a shift in the tendency towards centralization. In 2015 we started building Braveno. Market infrastructure is known as one of the hardest software systems to build, because it requires balancing several counteracting characteristics. It took us 3 years, but by 2018 we had a working platform. With the platform ready for operation, we finally reached the milestone where we could start onboarding early adopters. Since then we have worked with companies to issue alternative assets, and set up niche markets, and today we are bringing a well tested software stack to market, and building an ecosystem around it.

clojurejavajavascriptreacthtmldockerawscloud technologygitgithubkubernetesgoogle anlayticsamazon ec2amazon s3

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactawsgcpgraphqlremote workingflexible workinglaptop30 days annual leave + bank holidaysequipment budgetprivatetechnology

Media can be a complex and challenging landscape to navigate. We take brands on a journey from where they are to where they want to be; building on existing strengths, removing blockers and maximising opportunities across all components of their media ecosystem. Helping brands navigate change and engineer value since 2009, we are proud to work with a wide selection of global and domestic clients including Adidas, Coca-Cola, Sanofi, Just Eat, Virgin Media, Lloyds, Co-Op and Dyson. Our specialist advisory team brings together expertise from media and digital agencies, technology companies and brand marketing, to evaluate the effectiveness of each component of the media eco-system, determining where it can be improved.

clojurepythonc#node.jslinuxdockerawsansiblekubernetesslackaws lambdams teamslinux scriptinglinux server administration

Meltwater, a pioneer of media intelligence and now Outside Insight, gives businesses the information advantage they need to stay ahead. More than 30,000 companies have used Meltwater’s media intelligence to stay on top of billions of online conversations and extract relevant insights to strategically manage their brands. Meltwater is dedicated to personal, global service built on the local expertise of 55 offices across six continents. Meltwater is also committed to fostering the data science ecosystem through MEST, a pan-African entrepreneurial program and incubator, and Shack15, a global data science community. Learn more at meltwater.com. All of our solutions are fully web-based, offered as a service, and based on a modern technology stack. This is your opportunity to be part of a small agile team within a big multinational organization! We are more than 2000 people across the globe, so there is a lot going on. We believe in diversity and inclusion, and building teams with a wide variety of backgrounds and perspectives. This approach not only raises the quality of our products for our customers, but makes collaboration along the way much more fun. Read our underthehood blog to see which problems our engineers are solving. Also have a look at what life is like at Meltwater and visit our company profiles on LinkedIn, Xing, Facebook, and Twitter. Equal Opportunity Meltwater is firmly committed to affording equal employment opportunities to all candidates and employees alike without regard to race, color, religion, age, national origin, gender, sexual orientation, gender identity or gender expression, marital status disability, veteran status and we treat each individual with respect and dignity. The “EEO is the Law” poster is available at: http://bit.ly/2KBm9Ei And “EEO is the Law Supplement” poster is available at: http://bit.ly/2Kmxnxd On-Line Accessibility Directive: If you are an individual with a disability and require a reasonable accommodation to complete any part of the application process or are limited in the ability or unable to access or use this online application process and need an alternative method for applying, you may contact us here for assistance.

scalaclojurepythonjavarubyjavascriptangularreactdockerawsazuregcpkuberneteskafka

About Multis Multis provides financial services for companies holding euros, dollars, and cryptocurrencies. We are building the best crypto wallet designed for businesses who need to scale, move fast, make the most of their crypto and fiat currencies. We're helping these companies to shape a global and borderless economy through Decentralized Finance (DeFi)! We're a team of happy and passionate crypto-dreamers: Thibaut (CEO) and Greg (CTO), with backing from world-class US and European investors like Y Combinator, Coinbase Ventures and eFounders. The company is incorporated in San Francisco but we're working from Europe for now. What's so special about engineering at Multis? Multis engineering is working at the cutting edge of FinTech and Blockchain with powerful technologies like ClojureScript, Re-frame and Firebase. Our server-less architecture powered by functional programming is helping us to keep ourselves focused on our core domain and build a delightful experience. Our engineering principles? Simplicity, quality and a magical UX!

clojureclojurescriptremote workingcoffee machinegames roomcommitted to a diverse team relocation budgetfull visa assitanceearly stage venturecryptocurrency

Signal is a revolutionary new technology platform built for analysing text and discovering market intelligence, developed in partnership with the world's leading academics. Our large-scale text analytics system unlocks knowledge and insight from unstructured textual data, enabling organisations to solve complex information challenges and providing a competitive advantage for our clients in their respective markets.

clojureclojurescriptpythonnode.jsjavascriptangularreactdockerawscode qualitycompojuredynamodbrediselastisearch

Metabase is the easy, open source way for everyone in your company to ask questions and learn from data. Key features of the product: 5 minute setup Let anyone on your team ask questions without knowing SQL Rich beautiful dashboards with auto refresh and fullscreen SQL Mode for analysts and data pros Create canonical segments and metrics for your team to use Send data to Slack or email on a schedule with dashboard subscriptions View data in Slack anytime with MetaBot Humanize data for your team by renaming, annotating and hiding fields See changes in your data with alerts

clojureclojurescriptjavascriptreactcssgithubterraformsentrycircleciremote workinghealth insuranceseries btechnology

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockergoawsci/cd

H-E-B Digital is a little different than the average tech company. Like most corporate success stories, ours has a humble beginning, but it doesn’t start in a garage or with an algorithm. Instead, the H-E-B story starts with an ill husband, a determined wife, and three children to feed. Armed with just $60 and her wits, in 1905 our founder, Mrs. Florence Butt, opened a grocery store in her home and set in motion a generation-spanning commitment to feed not just her own children, but everyone in her state. 100+ years, 400+ stores, 5 different brands, one international expansion, and a few billion dollars in charitable contributions later, we’re getting closer to meeting that goal, but there’s still so much work to do. That’s where you come in. The digital arm of a brick and mortar institution, H-E-B Digital is tasked with providing solutions at scale for every part of the business. We create digital products for the millions of households that shop at H-E-B, but also for the 120,000+ employees who serve those households alongside us, from the teenager working their first job to the classically trained chef. But we don’t stop at the store: Our support spans from the farmers that grow our food to the drivers and warehouse workers that bring that food to the stores to the business functions that develop, source, package and sell that food, to the teams that give back to the community with the profits that food brings in. Our teams of engineers and analysts, designers and researchers, eCommerce experts and managers of all stripes are assembled and ready to tackle the hardest tech and digital problems. All we’re missing is you.

scalaclojurehaskellhealth insurancegenerous ptoflexible spending account401kprivateretail

Klarna was founded in 2005 in Stockholm, Sweden with the aim of making it easier for people to shop online. In the last 15 years, technology has evolved, excited and transformed the world around us, yet our mission remains as relevant as ever, to make paying as simple, safe and above all, smoooth as possible. Klarna is the leading global payments and shopping service, providing smarter and more flexible shopping and purchase experiences to 90 million active consumers across more than 250,000 merchants in 17 countries. Klarna offers direct payments, pay after delivery options and instalment plans in a smooth one-click purchase experience that lets consumers pay when and how they prefer to. When the company acquired SOFORT in 2014 the Klarna Group was formed. Klarna is backed by investors such as Sequoia Capital, Silver Lake, Bestseller Group, Dragoneer, Permira, Visa, Ant Group and Atomico. Klarna is used by companies such as H&M, Samsung, IKEA - and many more. Free breakfast every day 30 days of vacation Paid sick leave Pension contribution Wellness allowance Flexible working hours Listen more here. Klarna <3 Open-source

scalaclojurehaskellerlangpythonjavajavascriptflexible workinghealth insurancebookscareer advicepaid sick daysdaily stand upstock options

We're building a better financial world. Over the past ten years, we have built a machine learning and technology platform that is revolutionising how small businesses access finance. Business owners can complete a loan application and receive a decision in a matter of minutes, enabling them to get funding quickly at an affordable rate. Today, as the leading global provider for small business loans we have helped more than 100,000 small businesses access more than £11.5 billion in finance. Funding Circle is the largest online small business loans provider and one of the best-capitalised lending platforms in the world. The business is listed on the London Stock Exchange (Ticker: FCH). Our backers collectively manage over $5 trillion and are the leading firms behind Facebook, Twitter, Skype and Betfair. Build the incredible, with us!!

clojurejavarubyjavascriptreacthtmlcsslinuxdockerawsci/cdcode qualitycode reviewsfunctional programming