Through our dedicated tech hubs and the use of open source issues, WorksHub is changing the way Software Engineers find new opportunities. Our tech hubs bring together communities of Software Engineers 👩💻 where they can: Discover new companies hiring Get paid to solve real problems through our innovative Open Source issues solution Learn new skills through our Open Source issues or demonstrate skills on our learn section before applying to a new job Get expert advice on finding a new job with the support of one of our Talent Managers. Our Talent Managers focus on specific technologies in set geographies so we know how to speak your language whether that’s Clojure, Haskell, English or Japanese! For companies hiring we help them access the right talent in the right way! We are a team of Software Engineers, Data Scientists and Talent experts so we know how to represent the fastest growing tech companies. We believe that through our data-driven approach we can reduce the the time to hire from weeks to days. We are striving to build something amazing, we want to work on hard, interesting problems, and to surround ourselves with the brightest technology professionals in the world!

clojureclojurescriptmongodbherokualgoliaghost inspectorci/cd1passwordgithubsentrygoogle analytics sendgridslacksegment

Gooten is a workflow automation platform for eCommerce businesses to create products, market their businesses, and provide first mile logistics services on a global basis. Gooten's platform allows thousands of eCommerce companies to access on-demand production capacity, with an integrated product creation tool set that provides customization and personalization out of the box. Companies using Gooten increase efficiency, increase revenues through design optimization, and increase brand value through omni-channel distribution. Businesses powered by Gooten can source new products, identify new trends, run promotions, and track analytics on purchasers/repeat purchasers, while focusing business efforts on what drives revenues - creating developing and marketing brands and products.

clojurehaskellc#lisp.netmicrosoft azureremote workingflexible workinghealth insurancegym passeslearning budgetgenerous ptoparental leavecompany outings

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactgcpawsgraphqlremote workingflexible workinglaptopequipment budget30 days annual leave + bank holidaysprivatetechnology

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockercontinuous deploymentcontinuous integrationcloud

Through our dedicated tech hubs and the use of open source issues, WorksHub is changing the way Software Engineers find new opportunities. Our tech hubs bring together communities of Software Engineers 👩💻 where they can: Discover new companies hiring Get paid to solve real problems through our innovative Open Source issues solution Learn new skills through our Open Source issues or demonstrate skills on our learn section before applying to a new job Get expert advice on finding a new job with the support of one of our Talent Managers. Our Talent Managers focus on specific technologies in set geographies so we know how to speak your language whether that’s Clojure, Haskell, English or Japanese! For companies hiring we help them access the right talent in the right way! We are a team of Software Engineers, Data Scientists and Talent experts so we know how to represent the fastest growing tech companies. We believe that through our data-driven approach we can reduce the the time to hire from weeks to days. We are striving to build something amazing, we want to work on hard, interesting problems, and to surround ourselves with the brightest technology professionals in the world!

clojureclojurescriptmongodbherokualgoliaghost inspectorci/cd1passwordgithubsentrygoogle analytics sendgridslacksegment

clojurenode.jsjavascriptangularreact

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactgcpawsgraphqlremote workingflexible workinglaptopequipment budget30 days annual leave + bank holidaysprivatetechnology

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockercontinuous deploymentcontinuous integrationcloud

Through our dedicated tech hubs and the use of open source issues, WorksHub is changing the way Software Engineers find new opportunities. Our tech hubs bring together communities of Software Engineers 👩💻 where they can: Discover new companies hiring Get paid to solve real problems through our innovative Open Source issues solution Learn new skills through our Open Source issues or demonstrate skills on our learn section before applying to a new job Get expert advice on finding a new job with the support of one of our Talent Managers. Our Talent Managers focus on specific technologies in set geographies so we know how to speak your language whether that’s Clojure, Haskell, English or Japanese! For companies hiring we help them access the right talent in the right way! We are a team of Software Engineers, Data Scientists and Talent experts so we know how to represent the fastest growing tech companies. We believe that through our data-driven approach we can reduce the the time to hire from weeks to days. We are striving to build something amazing, we want to work on hard, interesting problems, and to surround ourselves with the brightest technology professionals in the world!

clojureclojurescriptmongodbherokualgoliaghost inspectorci/cd1passwordgithubsentrygoogle analytics sendgridslacksegment

PhoneWagon is a beautiful and easy to use call tracking software that helps businesses improve their marketing spend by placing unique local phone numbers on each of their different marketing campaigns. Businesses can turn off campaigns that aren't working and for the campaigns that are working, they can quickly test new ads to further improve ROI. PhoneWagon is suitable for agencies and small businesses that are looking for an online call tracking solution to understand their customer behavior and monitor the progress of their marketing campaigns. PhoneWagon also allows businesses to communicate with customers through text messages, both manually and automated. An example of an automated text message would be for a business to send a text message based on an event like a missed call. This engages prospects and prevents them from calling the next business on the list further improving ROI.

clojuredockervue.jsawsflexible working401kseedtechnology

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactgcpawsgraphqlremote workingflexible workinglaptopequipment budget30 days annual leave + bank holidaysprivatetechnology

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockercontinuous deploymentcontinuous integrationcloud

clojurenode.jsjavascriptangularreact

Through our dedicated tech hubs and the use of open source issues, WorksHub is changing the way Software Engineers find new opportunities. Our tech hubs bring together communities of Software Engineers 👩💻 where they can: Discover new companies hiring Get paid to solve real problems through our innovative Open Source issues solution Learn new skills through our Open Source issues or demonstrate skills on our learn section before applying to a new job Get expert advice on finding a new job with the support of one of our Talent Managers. Our Talent Managers focus on specific technologies in set geographies so we know how to speak your language whether that’s Clojure, Haskell, English or Japanese! For companies hiring we help them access the right talent in the right way! We are a team of Software Engineers, Data Scientists and Talent experts so we know how to represent the fastest growing tech companies. We believe that through our data-driven approach we can reduce the the time to hire from weeks to days. We are striving to build something amazing, we want to work on hard, interesting problems, and to surround ourselves with the brightest technology professionals in the world!

clojureclojurescriptmongodbherokualgoliaghost inspectorci/cd1passwordgithubsentrygoogle analytics sendgridslacksegment

Over 1 billion smallholder farmers produce 80% of the world's food, and four of the five most traded commodities on earth, yet the vast majority lack access to the internet and even basic information to help them solve problems or share ideas. No one has built a platform for these farmers. Until Wefarm. Wefarm is already the world’s largest farmer-to-farmer digital network, with more than 1 million farmers using our ecosystem in Kenya and Uganda alone. Our farmers share more than 40,000 questions and answers every day. Farmers connect with one another to solve problems, share ideas, and spread innovation, for free, and without needing an internet connection (Wefarm works even through SMS). Utilising the latest machine learning technology, Wefarm’s service gets bespoke, crowd- sourced information to help farmers increase yields, gain insight into pricing, tackle the effects of climate change, source the best quality seeds, fertiliser, and loans and diversify their agricultural interests. With the smallholder global agricultural market valued at over 400 billion USD, our vision is to create a digital online/ offline ecosystem for global smallholder agriculture. WeFarm has won Google’s prestigious Impact Challenge Award, the MEFFYS Award for Innovation in Technology, the Messaging and SMS World Awards’ Best SMS Solution, Business Rocks’ Global Startup Pitch Battle, Chivas Regal’s The Venture Competition’s UK prize, and 2nd place in their Global final and the European Union Commission’s Ideas from Europe Prize.

clojureclojurescriptdockerkuberneteskafkapostgresqlcode qualitycode reviewsslacknlpawsmachine learningmysqltravis-ci

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockercontinuous deploymentcontinuous integrationcloud

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactgcpawsgraphqlremote workingflexible workinglaptopequipment budget30 days annual leave + bank holidaysprivatetechnology

Through our dedicated tech hubs and the use of open source issues, WorksHub is changing the way Software Engineers find new opportunities. Our tech hubs bring together communities of Software Engineers 👩💻 where they can: Discover new companies hiring Get paid to solve real problems through our innovative Open Source issues solution Learn new skills through our Open Source issues or demonstrate skills on our learn section before applying to a new job Get expert advice on finding a new job with the support of one of our Talent Managers. Our Talent Managers focus on specific technologies in set geographies so we know how to speak your language whether that’s Clojure, Haskell, English or Japanese! For companies hiring we help them access the right talent in the right way! We are a team of Software Engineers, Data Scientists and Talent experts so we know how to represent the fastest growing tech companies. We believe that through our data-driven approach we can reduce the the time to hire from weeks to days. We are striving to build something amazing, we want to work on hard, interesting problems, and to surround ourselves with the brightest technology professionals in the world!

clojureclojurescriptmongodbherokualgoliaghost inspectorci/cd1passwordgithubsentrygoogle analytics sendgridslacksegment

Signal is a revolutionary new technology platform built for analysing text and discovering market intelligence, developed in partnership with the world's leading academics. Our large-scale text analytics system unlocks knowledge and insight from unstructured textual data, enabling organisations to solve complex information challenges and providing a competitive advantage for our clients in their respective markets.

clojureclojurescriptpythonnode.jsjavascriptangularreactdockerrediscode qualitydynamodbawscompojureelastisearch